PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta011672
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NF-YC
Protein Properties Length: 186aa    MW: 20464.8 Da    PI: 5.3949
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-38826PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC38.42.7e-12931712099
      NF-YC  20 elPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                ++P ar++++++++ d++ i  ea  l+ ka e f+ ++ + s+ h  e +++ l     +++v++ + ++fl d vp++
  Pta011672  93 AFPTARVRRVIRSEGDIR-INVEAAFLINKAAEKFLEQFVVDSFEHILEETKNILSYKPFSSTVANQKRYEFLADFVPEK 171
                69**************97.89********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.9E-1594170IPR009072Histone-fold
PfamPF008082.2E-794148IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471136.04E-12108171IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
XAGDITLLVA LADFIFLPKM KAANTPKSDS SAQSSSDFSE EQENADEKTL PTKIATDNGA  60
YSSPNIGEAE TPSRPVKSSH IKVPRPETPT TLAFPTARVR RVIRSEGDIR INVEAAFLIN  120
KAAEKFLEQF VVDSFEHILE ETKNILSYKP FSSTVANQKR YEFLADFVPE KVKAADALAR  180
RASAEI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.30950.0root| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008225482.11e-26PREDICTED: transcriptional regulator ATRX homolog
TrEMBLD5ACA92e-85D5ACA9_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.16e-20nuclear factor Y, subunit C10